Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 395,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 395,00 €
Data sheet of USP30 monoclonal antibody, clone CL4438
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,WB-Tr |
More info about USP30 monoclonal antibody, clone CL4438
| Brand: | Abnova |
| Reference: | MAB15709 |
| Product name: | USP30 monoclonal antibody, clone CL4438 |
| Product description: | Mouse monoclonal antibody raised against partial recombinant human USP30. |
| Clone: | CL4438 |
| Isotype: | IgG2a |
| Gene id: | 84749 |
| Gene name: | USP30 |
| Gene alias: | FLJ40511|MGC10702 |
| Gene description: | ubiquitin specific peptidase 30 |
| Immunogen: | Recombinant protein corresponding to human USP30. |
| Immunogen sequence/protein sequence: | IEAKGTLNGEKVEHQRTTFVKQLKLGKLPQCLCIHLQRLSWSSHGTPLKRHEHVQFNEFLMMDIYKYHLLGHKPSQHNPKLNKNPGPTLELQDGPGAPTPVLNQPGAPKTQIFMNGACSPSLLPTLSAPMPFPLPVVPDYSSST |
| Protein accession: | Q70CQ3 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500) Western Blot (1:500-1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot ((Transfected lysate) analysis of (1) control, (2) USP30 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY409983). |
| Applications: | IHC-P,WB-Tr |
| Shipping condition: | Dry Ice |