SMCHD1 monoclonal antibody, clone CL4265 View larger

SMCHD1 monoclonal antibody, clone CL4265

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMCHD1 monoclonal antibody, clone CL4265

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,IF

More info about SMCHD1 monoclonal antibody, clone CL4265

Brand: Abnova
Reference: MAB15706
Product name: SMCHD1 monoclonal antibody, clone CL4265
Product description: Mouse monoclonal antibody raised against partial recombinant human SMCHD1.
Clone: CL4265
Isotype: IgG1
Gene id: 23347
Gene name: SMCHD1
Gene alias: DKFZp686O0631|KIAA0650
Gene description: structural maintenance of chromosomes flexible hinge domain containing 1
Immunogen: Recombinant protein corresponding to human SMCHD1.
Immunogen sequence/protein sequence: DNGRGMTSKQLNNWAVYRLSKFTRQGDFESDHSGYVRPVPVPRSLNSDISYFGVGGKQAVFFVGQSARMISKPADSQDVHELVLSKED
Protein accession: A6NHR9
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15706-49-23-1.jpg
Application image note: Immunofluorescence staining of U-2 OS cell with antibody shows specific staining in the nucleoplasm in green. Microtubule- and nuclear probes are visualized in red and blue, respectively.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy SMCHD1 monoclonal antibody, clone CL4265 now

Add to cart