| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,IF |
| Brand: | Abnova |
| Reference: | MAB15706 |
| Product name: | SMCHD1 monoclonal antibody, clone CL4265 |
| Product description: | Mouse monoclonal antibody raised against partial recombinant human SMCHD1. |
| Clone: | CL4265 |
| Isotype: | IgG1 |
| Gene id: | 23347 |
| Gene name: | SMCHD1 |
| Gene alias: | DKFZp686O0631|KIAA0650 |
| Gene description: | structural maintenance of chromosomes flexible hinge domain containing 1 |
| Immunogen: | Recombinant protein corresponding to human SMCHD1. |
| Immunogen sequence/protein sequence: | DNGRGMTSKQLNNWAVYRLSKFTRQGDFESDHSGYVRPVPVPRSLNSDISYFGVGGKQAVFFVGQSARMISKPADSQDVHELVLSKED |
| Protein accession: | A6NHR9 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunofluorescence staining of U-2 OS cell with antibody shows specific staining in the nucleoplasm in green. Microtubule- and nuclear probes are visualized in red and blue, respectively. |
| Applications: | IHC-P,IF |
| Shipping condition: | Dry Ice |