BRAF monoclonal antibody, clone CL4003 View larger

BRAF monoclonal antibody, clone CL4003

New product

455,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BRAF monoclonal antibody, clone CL4003

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P

More info about BRAF monoclonal antibody, clone CL4003

Brand: Abnova
Reference: MAB15700
Product name: BRAF monoclonal antibody, clone CL4003
Product description: Mouse monoclonal antibody raised against partial recombinant human BRAF.
Clone: CL4003
Isotype: IgG1
Gene id: 673
Gene name: BRAF
Gene alias: B-RAF1|BRAF1|FLJ95109|MGC126806|MGC138284|RAFB1
Gene description: v-raf murine sarcoma viral oncogene homolog B1
Immunogen: Recombinant protein corresponding to human BRAF.
Immunogen sequence/protein sequence: PIPQEEASLAETALTSGSSPSAPASDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSS
Protein accession: P15056
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15700-48-12-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis shows strong cytoplasmic immunoreactivity in seminiferous tubules.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy BRAF monoclonal antibody, clone CL4003 now

Add to cart