| Brand | Abnova | 
| Product type | Primary antibodies | 
| Reactivity | Human | 
| Host species | Mouse | 
| Applications | WB-Ce,IHC-P | 
| Brand: | Abnova | 
| Reference: | MAB15677 | 
| Product name: | ERCC1 monoclonal antibody, clone CL1284 | 
| Product description: | Mouse monoclonal antibody raised against partial recombinant human ERCC1. | 
| Clone: | CL1284 | 
| Isotype: | IgG1 | 
| Gene id: | 2067 | 
| Gene name: | ERCC1 | 
| Gene alias: | COFS4|UV20 | 
| Gene description: | excision repair cross-complementing rodent repair deficiency, complementation group 1 (includes overlapping antisense sequence) | 
| Immunogen: | Recombinant protein corresponding to human ERCC1. | 
| Immunogen sequence/protein sequence: | LADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVP | 
| Protein accession: | P07992 | 
| Form: | Liquid | 
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500) Western Blot (1:500-1:1000) The optimal working dilution should be determined by the end user.  | 
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). | 
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.  | 
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. | 
| Product type: | Primary antibodies | 
| Host species: | Mouse | 
| Antigen species / target species: | Human | 
| Reactivity: | Human | 
| Application image: | ![]()  | 
| Application image note: | Western Blot analysis of RT-4 cell lysate with ERCC1 monoclonal antibody, clone CL1284 (Cat # MAB15677). | 
| Applications: | WB-Ce,IHC-P | 
| Shipping condition: | Dry Ice |