| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P |
| Brand: | Abnova |
| Reference: | MAB15671 |
| Product name: | CDH1 monoclonal antibody, clone CL1170 |
| Product description: | Mouse monoclonal antibody raised against partial recombinant human CDH1. |
| Clone: | CL1170 |
| Isotype: | IgG2b |
| Gene id: | 999 |
| Gene name: | CDH1 |
| Gene alias: | Arc-1|CD324|CDHE|ECAD|LCAM|UVO |
| Gene description: | cadherin 1, type 1, E-cadherin (epithelial) |
| Immunogen: | Recombinant protein corresponding to human CDH1. |
| Immunogen sequence/protein sequence: | ATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTIFFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEVGDYKINLKLMDNQNKDQVTTLEVSVCDCEGA |
| Protein accession: | P12830 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500) Western Blot (1:500-1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of Lane 1: MCF-7, Lane 2: SK-BR-3 and Lane 3: HeLa cell lysates with CDH1 monoclonal antibody, clone CL1170 (Cat # MAB15671). |
| Applications: | WB-Ce,IHC-P |
| Shipping condition: | Dry Ice |