No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IHC-P,WB-Tr |
Brand: | Abnova |
Reference: | MAB15668 |
Product name: | MCL1 monoclonal antibody, clone CL1128 |
Product description: | Mouse monoclonal antibody raised against partial recombinant human MCL1. |
Clone: | CL1128 |
Isotype: | IgG1 |
Gene id: | 4170 |
Gene name: | MCL1 |
Gene alias: | BCL2L3|EAT|MCL1L|MCL1S|MGC104264|MGC1839|TM |
Gene description: | myeloid cell leukemia sequence 1 (BCL2-related) |
Immunogen: | Recombinant protein corresponding to human MCL1. |
Immunogen sequence/protein sequence: | DAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDG |
Protein accession: | Q07820 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000) Western Blot (1:500-1:1000) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of Lane 1: negative control (vector only transfected HEK293T cell lysate) and Lane 2: over-expression lysate (co-expressed with a C-terminal myc-DDK tag in mammalian HEK293T cells) with MCL1 monoclonal antibody, clone CL1128 (Cat # MAB15668). |
Applications: | IHC-P,WB-Tr |
Shipping condition: | Dry Ice |