No products
Prices are tax excluded
| Brand | Abnova | 
| Product type | Primary antibodies | 
| Reactivity | Human | 
| Host species | Mouse | 
| Applications | IHC-P | 
| Brand: | Abnova | 
| Reference: | MAB15665 | 
| Product name: | RHOT1 monoclonal antibody, clone CL1095 | 
| Product description: | Mouse monoclonal antibody raised against partial recombinant human RHOT1. | 
| Clone: | CL1095 | 
| Isotype: | IgG1 | 
| Gene id: | 55288 | 
| Gene name: | RHOT1 | 
| Gene alias: | ARHT1|FLJ11040|FLJ12633|MIRO-1 | 
| Gene description: | ras homolog gene family, member T1 | 
| Immunogen: | Recombinant protein corresponding to human RHOT1. | 
| Immunogen sequence/protein sequence: | THIVDYSEAEQSDEQLHQEISQANVICIVYAVNNKHSIDKVTSRWIPLINERTDKDSRLPLILVGNKSDLVEYSSMETILPIMNQYTEIE | 
| Protein accession: | Q8IXI2 | 
| Form: | Liquid | 
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500) The optimal working dilution should be determined by the end user.  | 
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). | 
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.  | 
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. | 
| Product type: | Primary antibodies | 
| Host species: | Mouse | 
| Antigen species / target species: | Human | 
| Reactivity: | Human | 
| Application image: | ![]()  | 
| Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with RHOT1 monoclonal antibody, clone CL1095 (Cat # MAB15665) shows immunoreactivity in both neuronal cell bodies and neuropil. | 
| Applications: | IHC-P | 
| Shipping condition: | Dry Ice | 
| Publications: | DISC1-dependent Regulation of Mitochondrial Dynamics Controls the Morphogenesis of Complex Neuronal Dendrites.Norkett R, Modi S, Birsa N, Atkin TA, Ivankovic D, Pathania M, Trossbach SV, Korth C, Hirst WD, Kittler JT. J Biol Chem. 2016 Jan 8;291(2):613-29. doi: 10.1074/jbc.M115.699447. Epub 2015 Nov 9.  |