| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,WB-Tr |
| Brand: | Abnova |
| Reference: | MAB15640 |
| Product name: | ZNF703 monoclonal antibody, clone CL0654 |
| Product description: | Mouse monoclonal antibody raised against partial recombinant human ZNF703. |
| Clone: | CL0654 |
| Isotype: | IgG1 |
| Gene id: | 80139 |
| Gene name: | ZNF703 |
| Gene alias: | FLJ14299|ZNF503L |
| Gene description: | zinc finger protein 703 |
| Immunogen: | Recombinant protein corresponding to human ZNF703. |
| Immunogen sequence/protein sequence: | PYSKGSGGGDSRKDSGSSSVSSTSSSSSSSPGDKAGFRVPSAACPPFPPHGAPVSASSSSS |
| Protein accession: | Q9H7S9 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) Western Blot (1:500-1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of Lane 1: negative control (vector only transfected HEK293T cell lysate) and Lane 2: over-expression lysate (co-expressed with a C-terminal myc-DDK tag in mammalian HEK293T cells) with ZNF703 monoclonal antibody, clone CL0654 (Cat # MAB15640). |
| Applications: | IHC-P,WB-Tr |
| Shipping condition: | Dry Ice |