Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of STAT3 monoclonal antibody, clone CL0490
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P |
More info about STAT3 monoclonal antibody, clone CL0490
| Brand: | Abnova |
| Reference: | MAB15635 |
| Product name: | STAT3 monoclonal antibody, clone CL0490 |
| Product description: | Mouse monoclonal antibody raised against partial recombinant human STAT3. |
| Clone: | CL0490 |
| Isotype: | IgG1 |
| Gene id: | 6774 |
| Gene name: | STAT3 |
| Gene alias: | APRF|FLJ20882|HIES|MGC16063 |
| Gene description: | signal transducer and activator of transcription 3 (acute-phase response factor) |
| Immunogen: | Recombinant protein corresponding to human STAT3. |
| Immunogen sequence/protein sequence: | GVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECA |
| Protein accession: | P40763 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500) Western Blot (1:500-1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of RT-4 cell lysate with STAT3 monoclonal antibody, clone CL0490 (Cat # MAB15635). |
| Applications: | WB-Ce,IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | Nuclear receptor NR5A2 controls neural stem cell fate decisions during development.Stergiopoulos A, Politis PK. Nat Commun. 2016 Jul 22;7:12230. doi: 10.1038/ncomms12230. |