MTDH monoclonal antibody, clone CL0397 View larger

MTDH monoclonal antibody, clone CL0397

New product

455,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MTDH monoclonal antibody, clone CL0397

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P

More info about MTDH monoclonal antibody, clone CL0397

Brand: Abnova
Reference: MAB15627
Product name: MTDH monoclonal antibody, clone CL0397
Product description: Mouse monoclonal antibody raised against partial recombinant human MTDH.
Clone: CL0397
Isotype: IgG2a
Gene id: 92140
Gene name: MTDH
Gene alias: 3D3|AEG-1|AEG1|LYRIC
Gene description: metadherin
Immunogen: Recombinant protein corresponding to human MTDH.
Immunogen sequence/protein sequence: RKTEPSAWSQDTGDANTNGKDWGRSWSDRSIFSGIGSTAEPVSQSTTSDYQWDVSRNQPYIDDEWSGLNGLSSADPNSDWNAPAEEWGNWVDEERASLLKSQEPIPDDQKVSDDDKEKGEGALPTGKSKKKKKKKKKQGEDNSTAQD
Protein accession: Q86UE4
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15627-46-187-1.jpg
Application image note: Western Blot analysis of U-251 MG cell lysate with MTDH monoclonal antibody, clone CL0397 (Cat # MAB15627).
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Buy MTDH monoclonal antibody, clone CL0397 now

Add to cart