DICER1 monoclonal antibody, clone CL0378 View larger

DICER1 monoclonal antibody, clone CL0378

New product

455,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DICER1 monoclonal antibody, clone CL0378

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF

More info about DICER1 monoclonal antibody, clone CL0378

Brand: Abnova
Reference: MAB15623
Product name: DICER1 monoclonal antibody, clone CL0378
Product description: Mouse monoclonal antibody raised against partial recombinant human DICER1.
Clone: CL0378
Isotype: IgG2a
Gene id: 23405
Gene name: DICER1
Gene alias: DCR1|Dicer|HERNA|KIAA0928
Gene description: dicer 1, ribonuclease type III
Immunogen: Recombinant protein corresponding to human DICER1.
Immunogen sequence/protein sequence: PTDADSAYCVLPLNVVNDSSTLDIDFKFMEDIEKSEARIGIPSTKYTKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHLNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLH
Protein accession: Q9UPY3
Form: Liquid
Recommend dilutions: Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15623-49-4-1.jpg
Application image note: Immunofluorescent staining of A-431 cells with DICER1 monoclonal antibody, clone CL0378 (Cat # MAB15623) (Green) shows specific staining in the cytosol. Microtubule and nuclear probes are visualized in red and blue, respectively (where available).
Applications: WB-Ce,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy DICER1 monoclonal antibody, clone CL0378 now

Add to cart