| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,IF |
| Brand: | Abnova |
| Reference: | MAB15623 |
| Product name: | DICER1 monoclonal antibody, clone CL0378 |
| Product description: | Mouse monoclonal antibody raised against partial recombinant human DICER1. |
| Clone: | CL0378 |
| Isotype: | IgG2a |
| Gene id: | 23405 |
| Gene name: | DICER1 |
| Gene alias: | DCR1|Dicer|HERNA|KIAA0928 |
| Gene description: | dicer 1, ribonuclease type III |
| Immunogen: | Recombinant protein corresponding to human DICER1. |
| Immunogen sequence/protein sequence: | PTDADSAYCVLPLNVVNDSSTLDIDFKFMEDIEKSEARIGIPSTKYTKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHLNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLH |
| Protein accession: | Q9UPY3 |
| Form: | Liquid |
| Recommend dilutions: | Immunofluorescence (1-4 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500) Western Blot (1:500-1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunofluorescent staining of A-431 cells with DICER1 monoclonal antibody, clone CL0378 (Cat # MAB15623) (Green) shows specific staining in the cytosol. Microtubule and nuclear probes are visualized in red and blue, respectively (where available). |
| Applications: | WB-Ce,IHC-P,IF |
| Shipping condition: | Dry Ice |