WWTR1 monoclonal antibody, clone CL0371 View larger

WWTR1 monoclonal antibody, clone CL0371

New product

455,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of WWTR1 monoclonal antibody, clone CL0371

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF

More info about WWTR1 monoclonal antibody, clone CL0371

Brand: Abnova
Reference: MAB15621
Product name: WWTR1 monoclonal antibody, clone CL0371
Product description: Mouse monoclonal antibody raised against partial recombinant human WWTR1.
Clone: CL0371
Isotype: IgG1
Gene id: 25937
Gene name: WWTR1
Gene alias: DKFZp586I1419|TAZ
Gene description: WW domain containing transcription regulator 1
Immunogen: Recombinant protein corresponding to human WWTR1.
Immunogen sequence/protein sequence: MNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSST
Protein accession: Q9GZV5
Form: Liquid
Recommend dilutions: Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15621-49-outsr-1.jpg
Application image note: Immunofluorescent staining of SKMEL cells with WWTR1 monoclonal antibody, clone CL0371 (Cat # MAB15621) (Green) shows spotty nuclear staining. Microtubule probes are visualized in red (where available).
Applications: WB-Ce,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy WWTR1 monoclonal antibody, clone CL0371 now

Add to cart