MEF2C monoclonal antibody, clone CL0368 View larger

MEF2C monoclonal antibody, clone CL0368

New product

455,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MEF2C monoclonal antibody, clone CL0368

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,WB-Tr

More info about MEF2C monoclonal antibody, clone CL0368

Brand: Abnova
Reference: MAB15618
Product name: MEF2C monoclonal antibody, clone CL0368
Product description: Mouse monoclonal antibody raised against partial recombinant human MEF2C.
Clone: CL0368
Isotype: IgG1
Gene id: 4208
Gene name: MEF2C
Gene alias: -
Gene description: myocyte enhancer factor 2C
Immunogen: Recombinant protein corresponding to human MEF2C.
Immunogen sequence/protein sequence: PPNFEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPLAHPSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVNQRINN
Protein accession: Q06413
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15618-51-89-1.jpg
Application image note: Western Blot analysis of Lane 1: negative control (vector only transfected HEK293T cell lysate) and Lane 2: over-expression lysate (co-expressed with a C-terminal myc-DDK tag in mammalian HEK293T cells) with MEF2C monoclonal antibody, clone CL0368 (Cat # MAB15618).
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MEF2C monoclonal antibody, clone CL0368 now

Add to cart