NAPRT1 monoclonal antibody, clone CL0366 View larger

NAPRT1 monoclonal antibody, clone CL0366

New product

455,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NAPRT1 monoclonal antibody, clone CL0366

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,IHC-P

More info about NAPRT1 monoclonal antibody, clone CL0366

Brand: Abnova
Reference: MAB15617
Product name: NAPRT1 monoclonal antibody, clone CL0366
Product description: Mouse monoclonal antibody raised against partial recombinant human NAPRT1.
Clone: CL0366
Isotype: IgG1
Gene id: 93100
Gene name: NAPRT1
Gene alias: PP3856
Gene description: nicotinate phosphoribosyltransferase domain containing 1
Immunogen: Recombinant protein corresponding to human NAPRT1.
Immunogen sequence/protein sequence: LLDTYSVWRSGLPNFLAVALALGELGYRAVGVRLDSGDLLQQAQEIRKVFRAAAAQFQVPWLESVLIVVSNNIDEEALARLAQEGSEVNVIGIGTSV
Protein accession: Q6XQN6
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15617-47-8-1.jpg
Application image note: Western Blot analysis of human liver tissue lysate with NAPRT1 monoclonal antibody, clone CL0366 (Cat # MAB15617).
Applications: WB-Ti,IHC-P
Shipping condition: Dry Ice

Reviews

Buy NAPRT1 monoclonal antibody, clone CL0366 now

Add to cart