CNDP1 monoclonal antibody, clone CL0339 View larger

CNDP1 monoclonal antibody, clone CL0339

New product

455,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CNDP1 monoclonal antibody, clone CL0339

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti

More info about CNDP1 monoclonal antibody, clone CL0339

Brand: Abnova
Reference: MAB15608
Product name: CNDP1 monoclonal antibody, clone CL0339
Product description: Mouse monoclonal antibody raised against partial recombinant human CNDP1.
Clone: CL0339
Isotype: IgG1
Gene id: 84735
Gene name: CNDP1
Gene alias: CN1|CPGL2|HsT2308|MGC102737|MGC10825|MGC142072
Gene description: carnosine dipeptidase 1 (metallopeptidase M20 family)
Immunogen: Recombinant protein corresponding to human CNDP1.
Immunogen sequence/protein sequence: PALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLPDGQSLPIPPVILAELGSDPTKGTVCFYGHL
Protein accession: Q96KN2
Form: Liquid
Recommend dilutions: Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15608-47-F2-1.jpg
Application image note: Western Blot analysis of human plasma tissue lysate with CNDP1 monoclonal antibody, clone CL0339 (Cat # MAB15608).
Applications: WB-Ti
Shipping condition: Dry Ice

Reviews

Buy CNDP1 monoclonal antibody, clone CL0339 now

Add to cart