ANLN monoclonal antibody, clone CL0303 View larger

ANLN monoclonal antibody, clone CL0303

New product

455,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ANLN monoclonal antibody, clone CL0303

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF

More info about ANLN monoclonal antibody, clone CL0303

Brand: Abnova
Reference: MAB15596
Product name: ANLN monoclonal antibody, clone CL0303
Product description: Mouse monoclonal antibody raised against partial recombinant human ANLN.
Clone: CL0303
Isotype: IgG1
Gene id: 54443
Gene name: ANLN
Gene alias: DKFZp779A055|Scraps|scra
Gene description: anillin, actin binding protein
Immunogen: Recombinant protein corresponding to human ANLN.
Immunogen sequence/protein sequence: IVKSTLSQTVPSKGELSREICLQSQSKDKSTTPGGTGIKPFLERFGERCQEHSKESPARSTPHRTPIITPNTKAIQERLFKQDTSSSTTHLAQQLKQERQKELACLRGRFDKGNIWSAEKGGNSKSKQLETKQETH
Protein accession: Q9NQW6
Form: Liquid
Recommend dilutions: Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15596-49-1-1.jpg
Application image note: Immunofluorescent staining of HeLa cells with ANLN monoclonal antibody, clone CL0303 (Cat # MAB15596) (Green) shows cell cycle dependent nuclear (without nucleoli) staining. Microtubule and nuclear probes are visualized in red and blue respectively (where available).
Applications: WB-Ce,IHC-P,IF
Shipping condition: Dry Ice

Buy ANLN monoclonal antibody, clone CL0303 now

Add to cart