| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,IF |
| Brand: | Abnova |
| Reference: | MAB15594 |
| Product name: | RBM3 monoclonal antibody, clone CL0296 |
| Product description: | Mouse monoclonal antibody raised against partial recombinant human RBM3. |
| Clone: | CL0296 |
| Isotype: | IgG1 |
| Gene id: | 5935 |
| Gene name: | RBM3 |
| Gene alias: | IS1-RNPL|RNPL |
| Gene description: | RNA binding motif (RNP1, RRM) protein 3 |
| Immunogen: | Recombinant protein corresponding to human RBM3. |
| Immunogen sequence/protein sequence: | DEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGNY |
| Protein accession: | P98179 |
| Form: | Liquid |
| Recommend dilutions: | Immunofluorescence (1-4 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000) Western Blot (1:500-1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunofluorescent staining of U-2 OS cells with RBM3 monoclonal antibody, clone CL0296 (Cat # MAB15594) (Green) shows specific staining in the nucleoplasm. Microtubule and nuclear probes are visualized in red and blue, respectively (where available). |
| Applications: | WB-Ce,IHC-P,IF |
| Shipping condition: | Dry Ice |
| Publications: | Low RBM3 protein expression correlates with clinical stage, prognostic classification and increased risk of treatment failure in testicular non-seminomatous germ cell cancer.Olofsson SE, Nodin B, Gaber A, Eberhard J, Uhlen M, Jirstrom K, Jerkeman M. PLoS One. 2015 Mar 26;10(3):e0121300. doi: 10.1371/journal.pone.0121300. eCollection 2015. |