| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,IHC-P |
| Brand: | Abnova |
| Reference: | MAB15585 |
| Product name: | SCGN monoclonal antibody, clone CL0271 |
| Product description: | Mouse monoclonal antibody raised against partial recombinant human SCGN. |
| Clone: | CL0271 |
| Isotype: | IgG1 |
| Gene id: | 10590 |
| Gene name: | SCGN |
| Gene alias: | CALBL|DJ501N12.8|SECRET|SEGN|setagin |
| Gene description: | secretagogin, EF-hand calcium binding protein |
| Immunogen: | Recombinant protein corresponding to human SCGN. |
| Immunogen sequence/protein sequence: | RDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLK |
| Protein accession: | O76038 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:2500-1:5000) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of human brain tissue lysate with SCGN monoclonal antibody, clone CL0271 (Cat # MAB15585). |
| Applications: | WB-Ti,IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | Secretagogin is expressed in sensory CGRP neurons and in spinal cord of mouse and complements other calcium-binding proteins, with a note on rat and human.Shi TJ, Xiang Q, Zhang MD, Tortoriello G, Hammarberg H, Mulder J, Fried K, Wagner L, Josephson A, Uhlen M, Harkany T, Hokfelt T. Mol Pain. 2012 Oct 29;8:80. doi: 10.1186/1744-8069-8-80. |