ERBB2 monoclonal antibody, clone CL0269 View larger

ERBB2 monoclonal antibody, clone CL0269

New product

455,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ERBB2 monoclonal antibody, clone CL0269

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P

More info about ERBB2 monoclonal antibody, clone CL0269

Brand: Abnova
Reference: MAB15584
Product name: ERBB2 monoclonal antibody, clone CL0269
Product description: Mouse monoclonal antibody raised against partial recombinant human ERBB2.
Clone: CL0269
Isotype: IgG2a
Gene id: 2064
Gene name: ERBB2
Gene alias: CD340|HER-2|HER-2/neu|HER2|NEU|NGL|TKR1
Gene description: v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian)
Immunogen: Recombinant protein corresponding to human ERBB2.
Immunogen sequence/protein sequence: YNTDTFESMPNPEGRYTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFGAPHR
Protein accession: P04626
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15584-46-10-1.jpg
Application image note: Western Blot analysis of SK-BR-3 cell lysate with ERBB2 monoclonal antibody, clone CL0269 (Cat # MAB15584).
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy ERBB2 monoclonal antibody, clone CL0269 now

Add to cart