TSPAN7 monoclonal antibody, clone CL0262 View larger

TSPAN7 monoclonal antibody, clone CL0262

New product

455,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TSPAN7 monoclonal antibody, clone CL0262

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,WB-Tr

More info about TSPAN7 monoclonal antibody, clone CL0262

Brand: Abnova
Reference: MAB15581
Product name: TSPAN7 monoclonal antibody, clone CL0262
Product description: Mouse monoclonal antibody raised against partial recombinant human TSPAN7.
Clone: CL0262
Isotype: IgG1
Gene id: 7102
Gene name: TSPAN7
Gene alias: A15|CCG-B7|CD231|DXS1692E|MRX58|MXS1|TALLA-1|TM4SF2|TM4SF2b
Gene description: tetraspanin 7
Immunogen: Recombinant protein corresponding to human TSPAN7.
Immunogen sequence/protein sequence: TFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMET
Protein accession: P41732
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15581-51-89-1.jpg
Application image note: Western Blot analysis of Lane 1: negative control (vector only transfected HEK293T cell lysate) and Lane 2: over-expression lysate (co-expressed with a C-terminal myc-DDK tag in mammalian HEK293T cells) with TSPAN7 monoclonal antibody, clone CL0262 (Cat # MAB15581).
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TSPAN7 monoclonal antibody, clone CL0262 now

Add to cart