STX7 monoclonal antibody, clone CL0257 View larger

STX7 monoclonal antibody, clone CL0257

New product

455,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of STX7 monoclonal antibody, clone CL0257

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,IHC-P

More info about STX7 monoclonal antibody, clone CL0257

Brand: Abnova
Reference: MAB15578
Product name: STX7 monoclonal antibody, clone CL0257
Product description: Mouse monoclonal antibody raised against partial recombinant human STX7.
Clone: CL0257
Isotype: IgG1
Gene id: 8417
Gene name: STX7
Gene alias: -
Gene description: syntaxin 7
Immunogen: Recombinant protein corresponding to human STX7.
Immunogen sequence/protein sequence: GVGGDPAQLAQRISSNIQKITQCSVEIQRTLNQLGTPQDSPELRQQLQQKQQYTNQLAKETDKYIKEFGSLPTTPSEQRQRKIQKDRLVAEFTTSLTNFQKVQRQAAEREKEFVARVRASSRVSGSFPEDSSKERNLVSWESQTQPQV
Protein accession: O15400
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15578-47-5-1.jpg
Application image note: Western Blot analysis of human tonsil tissue lysate with STX7 monoclonal antibody, clone CL0257 (Cat # MAB15578).
Applications: WB-Ti,IHC-P
Shipping condition: Dry Ice

Reviews

Buy STX7 monoclonal antibody, clone CL0257 now

Add to cart