VANGL1 monoclonal antibody, clone CL0241 View larger

VANGL1 monoclonal antibody, clone CL0241

New product

455,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of VANGL1 monoclonal antibody, clone CL0241

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF

More info about VANGL1 monoclonal antibody, clone CL0241

Brand: Abnova
Reference: MAB15577
Product name: VANGL1 monoclonal antibody, clone CL0241
Product description: Mouse monoclonal antibody raised against partial recombinant human VANGL1.
Clone: CL0241
Isotype: IgG1
Gene id: 81839
Gene name: VANGL1
Gene alias: LPP2|MGC5338|STB2|STBM2
Gene description: vang-like 1 (van gogh, Drosophila)
Immunogen: Recombinant protein corresponding to human VANGL1.
Immunogen sequence/protein sequence: DTESTYSGYSYYSSHSKKSHRQGERTRERHKSPRNKDGRGSEKSVTIQPPTGEPLLGNDSTRTEEVQDDNWGETTTAITGTSEHSISQEDIARISKDMEDSVGLDCKRY
Protein accession: Q8TAA9
Form: Liquid
Recommend dilutions: Immunofluorescence (1-4 ug/mL)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15577-49-4-1.jpg
Application image note: Immunofluorescent staining of A-431 cells with VANGL1 monoclonal antibody, clone CL0241 (Cat # MAB15577) (Green) shows specific staining of plasma membrane. Microtubule and nuclear probes are visualized in red and blue, respectively (where available).
Applications: WB-Ce,IF
Shipping condition: Dry Ice

Reviews

Buy VANGL1 monoclonal antibody, clone CL0241 now

Add to cart