Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products
Total shipping To be determined
Total
Data sheet of S100A4 monoclonal antibody, clone CL0240
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,IHC-P,IF |
More info about S100A4 monoclonal antibody, clone CL0240
| Brand: | Abnova |
| Reference: | MAB15576 |
| Product name: | S100A4 monoclonal antibody, clone CL0240 |
| Product description: | Mouse monoclonal antibody raised against partial recombinant human S100A4. |
| Clone: | CL0240 |
| Isotype: | IgG1 |
| Gene id: | 6275 |
| Gene name: | S100A4 |
| Gene alias: | 18A2|42A|CAPL|FSP1|MTS1|P9KA|PEL98 |
| Gene description: | S100 calcium binding protein A4 |
| Immunogen: | Recombinant protein corresponding to human S100A4. |
| Immunogen sequence/protein sequence: | MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK |
| Protein accession: | P26447 |
| Form: | Liquid |
| Recommend dilutions: | Immunofluorescence (1-4 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:2500-1:5000) Western Blot (1:500-1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescent staining of BJ cells with S100A4 monoclonal antibody, clone CL0240 (Cat # MAB15576) (Green) shows specific staining in the plasma membrane. Microtubule and nuclear probes are visualized in red and blue, respectively (where available). |
| Applications: | WB-Ti,IHC-P,IF |
| Shipping condition: | Dry Ice |
| Publications: | COX/mPGES-1/PGE2 pathway depicts an inflammatory-dependent high-risk neuroblastoma subset.Larsson K, Kock A, Idborg H, Arsenian Henriksson M, Martinsson T, Johnsen JI, Korotkova M, Kogner P, Jakobsson PJ. Proc Natl Acad Sci U S A. 2015 Jun 30;112(26):8070-5. doi: 10.1073/pnas.1424355112. Epub 2015 Jun 15. |