FABP7 monoclonal antibody, clone CL0236 View larger

FABP7 monoclonal antibody, clone CL0236

New product

455,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FABP7 monoclonal antibody, clone CL0236

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P

More info about FABP7 monoclonal antibody, clone CL0236

Brand: Abnova
Reference: MAB15573
Product name: FABP7 monoclonal antibody, clone CL0236
Product description: Mouse monoclonal antibody raised against partial recombinant human FABP7.
Clone: CL0236
Isotype: IgG1
Gene id: 2173
Gene name: FABP7
Gene alias: B-FABP|BLBP|DKFZp547J2313|FABPB|MRG
Gene description: fatty acid binding protein 7, brain
Immunogen: Recombinant protein corresponding to human FABP7.
Immunogen sequence/protein sequence: MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCK
Protein accession: O15540
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15573-46-187-1.jpg
Application image note: Western Blot analysis of U-251 MG cell lysate with FABP7 monoclonal antibody, clone CL0236 (Cat # MAB15573).
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy FABP7 monoclonal antibody, clone CL0236 now

Add to cart