RNASE7 monoclonal antibody, clone CL0223 View larger

RNASE7 monoclonal antibody, clone CL0223

New product

455,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RNASE7 monoclonal antibody, clone CL0223

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,WB-Tr

More info about RNASE7 monoclonal antibody, clone CL0223

Brand: Abnova
Reference: MAB15567
Product name: RNASE7 monoclonal antibody, clone CL0223
Product description: Mouse monoclonal antibody raised against partial recombinant human RNASE7.
Clone: CL0223
Isotype: IgG1
Gene id: 84659
Gene name: RNASE7
Gene alias: MGC133220
Gene description: ribonuclease, RNase A family, 7
Immunogen: Recombinant protein corresponding to human RNASE7.
Immunogen sequence/protein sequence: KGMTSSQWFKIQHMQPSPQACNSAMKNINKHTKRCKDLNTFLHEPFSSVAATCQTPKIACKNGDKNCHQSHGPVSLTMCKLTSGKYPNCRYKEKRQNKSYVVACKPPQKKDSQQFHLVPVHLDRV
Protein accession: Q9H1E1
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15567-51-89-1.jpg
Application image note: Western Blot analysis of Lane 1: negative control (vector only transfected HEK293T cell lysate) and Lane 2: over-expression lysate (co-expressed with a C-terminal myc-DDK tag in mammalian HEK293T cells) with RNASE7 monoclonal antibody, clone CL0223 (Cat # MAB15567).
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RNASE7 monoclonal antibody, clone CL0223 now

Add to cart