NLRP3 monoclonal antibody, clone CL0210 View larger

NLRP3 monoclonal antibody, clone CL0210

New product

455,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NLRP3 monoclonal antibody, clone CL0210

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce

More info about NLRP3 monoclonal antibody, clone CL0210

Brand: Abnova
Reference: MAB15562
Product name: NLRP3 monoclonal antibody, clone CL0210
Product description: Mouse monoclonal antibody raised against partial recombinant human NLRP3.
Clone: CL0210
Isotype: IgG1
Gene id: 114548
Gene name: NLRP3
Gene alias: AGTAVPRL|AII|AII/AVP|AVP|C1orf7|CIAS1|CLR1.1|FCAS|FCU|FLJ95925|MWS|NALP3|PYPAF1
Gene description: NLR family, pyrin domain containing 3
Immunogen: Recombinant protein corresponding to human NLRP3.
Immunogen sequence/protein sequence: FKMHLEDYPPQKGCIPLPRGQTEKADHVDLATLMIDFNGEEKAWAMAVWIFAAINRRDLYEKAKRDEPKWGSDNARVSNPTVICQEDSIEEEWMGLLEYLSRISICKMKKDYRKKYR
Protein accession: Q96P20
Form: Liquid
Recommend dilutions: Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15562-46-multi-1.jpg
Application image note: Western Blot analysis of Lane 1: RT-4 and Lane 2: U-251 MG cell lysates with NLRP3 monoclonal antibody, clone CL0210 (Cat # MAB15562).
Applications: WB-Ce
Shipping condition: Dry Ice

Reviews

Buy NLRP3 monoclonal antibody, clone CL0210 now

Add to cart