PCM1 monoclonal antibody, clone CL0206 View larger

PCM1 monoclonal antibody, clone CL0206

New product

455,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PCM1 monoclonal antibody, clone CL0206

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P

More info about PCM1 monoclonal antibody, clone CL0206

Brand: Abnova
Reference: MAB15561
Product name: PCM1 monoclonal antibody, clone CL0206
Product description: Mouse monoclonal antibody raised against partial recombinant human PCM1.
Clone: CL0206
Isotype: IgG1
Gene id: 5108
Gene name: PCM1
Gene alias: PTC4
Gene description: pericentriolar material 1
Immunogen: Recombinant protein corresponding to human PCM1.
Immunogen sequence/protein sequence: TIYSEVATLISQNESRPHFLIELFHELQLLNTDYLRQRALYALQDIVSRHISESHEKGENVKSVNSGTWIASNSELTPSESLATTDDETFEKNFE
Protein accession: Q15154
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15561-46-187-1.jpg
Application image note: Western Blot analysis of U-251 cell lysate with PCM1 monoclonal antibody, clone CL0206 (Cat # MAB15561).
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy PCM1 monoclonal antibody, clone CL0206 now

Add to cart