| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P |
| Brand: | Abnova |
| Reference: | MAB15551 |
| Product name: | ADAR monoclonal antibody, clone CL0176 |
| Product description: | Mouse monoclonal antibody raised against partial recombinant human ADAR. |
| Clone: | CL0176 |
| Isotype: | IgG1 |
| Gene id: | 103 |
| Gene name: | ADAR |
| Gene alias: | ADAR1|DRADA|DSH|DSRAD|G1P1|IFI-4|IFI4|K88dsRBP|p136 |
| Gene description: | adenosine deaminase, RNA-specific |
| Immunogen: | Recombinant protein corresponding to human ADAR. |
| Immunogen sequence/protein sequence: | SDNQPEGMISESLDNLESMMPNKVRKIGELVRYLNTNPVGGLLEYARSHGFAAEFKLVDQSGPPHEPKFVYQAKVGGRWFPAVCAHSKKQGKQEAADAALRVLIGENEKAERMGFTEVTPVTGASLRRTMLLLSRSPEA |
| Protein accession: | P55265 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000) Western Blot (1:500-1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of U-251 MG cell lysate with ADAR monoclonal antibody, clone CL0176 (Cat # MAB15551). |
| Applications: | WB-Ce,IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | Gene amplification-associated overexpression of the RNA editing enzyme ADAR1 enhances human lung tumorigenesis.Anadon C, Guil S, Simo-Riudalbas L, Moutinho C, Setien F, Martinez-Cardus A, Moran S, Villanueva A, Calaf M, Vidal A, Lazo PA, Zondervan I, Savola S, Kohno T, Yokota J, Ribas de Pouplana L, Esteller M. Oncogene. 2016 Aug 18;35(33):4407-13. doi: 10.1038/onc.2015.469. Epub 2015 Dec 7. |