View larger

RHOC (Human) Recombinant Protein (P01)

New product

374,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RHOC (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about RHOC (Human) Recombinant Protein (P01)

Brand: Abnova
Reference: H00000389-P01
Product name: RHOC (Human) Recombinant Protein (P01)
Product description: Human RHOC full-length ORF ( AAH07245, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 389
Gene name: RHOC
Gene alias: ARH9|ARHC|H9|MGC1448|MGC61427|RHOH9
Gene description: ras homolog gene family, member C
Genbank accession: BC007245
Immunogen sequence/protein sequence: MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL
Protein accession: AAH07245
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00000389-P01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Flow Cytometry for Real-Time Measurement of Guanine Nucleotide Binding and Exchange by Ras-like GTPases.Schwartz SL, Tessema M, Buranda T, Pylypenko O, Rak A, Simons PC, Surviladze Z, Sklar LA, Wandinger-Ness A.
Anal Biochem. 2008 Oct 15;381(2):258-66. Epub 2008 Jul 8.

Reviews

Buy RHOC (Human) Recombinant Protein (P01) now

Add to cart