View larger

APCS (Human) Recombinant Protein (Q02)

New product

374,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of APCS (Human) Recombinant Protein (Q02)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about APCS (Human) Recombinant Protein (Q02)

Brand: Abnova
Reference: H00000325-Q02
Product name: APCS (Human) Recombinant Protein (Q02)
Product description: Human APCS partial ORF ( AAH07058.1, 35 a.a. - 149 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 325
Gene name: APCS
Gene alias: MGC88159|PTX2|SAP
Gene description: amyloid P component, serum
Genbank accession: BC007058
Immunogen sequence/protein sequence: VTDHVNLITPLEKPLQNFTLCFRAYSDLSRAYSLFSYNTQGRDNELLVYKERVGEYSLYIGRHKVTSKVIEKFPAPVHICVSWESSSGIAEFWINGTPLVKKGLRQGYFVEAQPK
Protein accession: AAH07058.1
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00000325-Q02-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Buy APCS (Human) Recombinant Protein (Q02) now

Add to cart