No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Proteins |
| Host species | Wheat Germ (in vitro) |
| Applications | AP,Array,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00000301-Q01 |
| Product name: | ANXA1 (Human) Recombinant Protein (Q01) |
| Product description: | Human ANXA1 partial ORF ( AAH01275, 237 a.a. - 346 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 301 |
| Gene name: | ANXA1 |
| Gene alias: | ANX1|LPC1 |
| Gene description: | annexin A1 |
| Genbank accession: | BC001275 |
| Immunogen sequence/protein sequence: | FQKYTKYSKHDMNKVLDLELKGDIEKCLTAIVKCATSKPAFFAEKLHQAMKGVGTRHKALIRIMVSRSEIDMNDIKAFYQKMYGISLCQAILDETKGDYEKILVALCGGN |
| Protein accession: | AAH01275 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quality control testing picture: | ![]() |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Product type: | Proteins |
| Host species: | Wheat Germ (in vitro) |
| Antigen species / target species: | Human |
| Applications: | AP,Array,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Factor Xa Binding to Annexin 2 Mediates Signal Transduction via Protease-Activated Receptor 1.Bhattacharjee G, Ahamed J, Pawlinski R, Liu C, Mackman N, Ruf W, Edgington TS. Circ Res. 2008 Feb 29;102(4):457-64. Epub 2008 Jan 3. |