Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ETS1 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Rabbit |
| Applications | WB-Ti,WB-Tr,PLA-Ce |
More info about ETS1 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00002113-D01P |
| Product name: | ETS1 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human ETS1 protein. |
| Gene id: | 2113 |
| Gene name: | ETS1 |
| Gene alias: | ETS-1|EWSR2|FLJ10768 |
| Gene description: | v-ets erythroblastosis virus E26 oncogene homolog 1 (avian) |
| Genbank accession: | NM_005238.2 |
| Immunogen: | ETS1 (NP_005229.1, 1 a.a. ~ 441 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDADE |
| Protein accession: | NP_005229.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | ETS1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ETS1 expression in human spleen. |
| Applications: | WB-Ti,WB-Tr,PLA-Ce |
| Shipping condition: | Dry Ice |
| Publications: | Endothelial enriched microRNAs regulate angiotensin II-induced endothelial inflammation and migration.Zhu N, Zhang D, Chen S, Liu X, Lin L, Huang X, Guo Z, Liu J, Wang Y, Yuan W, Qin Y. Atherosclerosis. 2011 Jan 19. [Epub ahead of print] |