> >>CNTF purified MaxPab rabbit polyclonal antibody (D01P)
CNTF purified MaxPab rabbit polyclonal antibody (D01P) View larger

CNTF purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language
Rate it

Data sheet of CNTF purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about CNTF purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00001270-D01P
Product name: CNTF purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human CNTF protein.
Gene id: 1270
Gene name: CNTF
Gene alias: HCNTF
Gene description: ciliary neurotrophic factor
Genbank accession: NM_000614
Immunogen: CNTF (NP_000605.1, 1 a.a. ~ 200 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM
Protein accession: NP_000605.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00001270-D01P-13-15-1.jpg
Application image note: Western Blot analysis of CNTF expression in transfected 293T cell line (H00001270-T01) by CNTF MaxPab polyclonal antibody.

Lane 1: CNTF transfected lysate(22.90 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CNTF purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart