| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr,IP |
| Brand: | Abnova |
| Reference: | H00001270-D01 |
| Product name: | CNTF MaxPab rabbit polyclonal antibody (D01) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human CNTF protein. |
| Gene id: | 1270 |
| Gene name: | CNTF |
| Gene alias: | HCNTF |
| Gene description: | ciliary neurotrophic factor |
| Genbank accession: | NM_000614 |
| Immunogen: | CNTF (NP_000605.1, 1 a.a. ~ 200 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM |
| Protein accession: | NP_000605.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of CNTF expression in transfected 293T cell line (H00001270-T01) by CNTF MaxPab polyclonal antibody. Lane 1: CNTF transfected lysate(22.9 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr,IP |
| Shipping condition: | Dry Ice |