| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
| Brand: | Abnova |
| Reference: | H00001164-B01P |
| Product name: | CKS2 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human CKS2 protein. |
| Gene id: | 1164 |
| Gene name: | CKS2 |
| Gene alias: | CKSHS2 |
| Gene description: | CDC28 protein kinase regulatory subunit 2 |
| Genbank accession: | BC006458.1 |
| Immunogen: | CKS2 (AAH06458.1, 1 a.a. ~ 79 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK |
| Protein accession: | AAH06458.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of CKS2 expression in transfected 293T cell line (H00004085-T02) by CKS2 MaxPab polyclonal antibody. Lane 1: CKS2 transfected lysate(8.80 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |