CDH5 polyclonal antibody (A01) View larger

CDH5 polyclonal antibody (A01)

New product

286,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CDH5 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about CDH5 polyclonal antibody (A01)

Brand: Abnova
Reference: H00001003-A01
Product name: CDH5 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant CDH5.
Gene id: 1003
Gene name: CDH5
Gene alias: 7B4|CD144|FLJ17376
Gene description: cadherin 5, type 2 (vascular endothelium)
Genbank accession: NM_001795
Immunogen: CDH5 (NP_001786, 51 a.a. ~ 150 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: WNQMHIDEEKNTSLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTAVIVDKDTGENLETPSSFTIKVHDVNDNWPV
Protein accession: NP_001786
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001003-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00001003-A01-1-11-1.jpg
Application image note: CDH5 polyclonal antibody (A01), Lot # 051003JCO1 Western Blot analysis of CDH5 expression in PC-12 ( Cat # L012V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CDH5 polyclonal antibody (A01) now

Add to cart