CD40 (Human) Recombinant Protein (P02) View larger

CD40 (Human) Recombinant Protein (P02)

New product

374,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CD40 (Human) Recombinant Protein (P02)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about CD40 (Human) Recombinant Protein (P02)

Brand: Abnova
Reference: H00000958-P02
Product name: CD40 (Human) Recombinant Protein (P02)
Product description: Human CD40 full-length ORF ( NP_001241, 1 a.a. - 277 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 958
Gene name: CD40
Gene alias: Bp50|CDW40|MGC9013|TNFRSF5|p50
Gene description: CD40 molecule, TNF receptor superfamily member 5
Genbank accession: NM_001250.1
Immunogen sequence/protein sequence: MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Protein accession: NP_001241
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00000958-P02-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CD40 (Human) Recombinant Protein (P02) now

Add to cart