| Reference: | H00064318-A01 |
| Product name: | NOC3L polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant NOC3L. |
| Gene id: | 64318 |
| Gene name: | NOC3L |
| Gene alias: | AD24|C10orf117|FAD24|FLJ12820 |
| Gene description: | nucleolar complex associated 3 homolog (S. cerevisiae) |
| Genbank accession: | NM_022451 |
| Immunogen: | NOC3L (NP_071896, 702 a.a. ~ 800 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | PIVQRFAAHLIAGAPSEGSGALKPELSRRSATELFEAYSMAEMTFNPPVESSNPKIKGKFLQGDSFLNEDLNQLIKRYSSEVATESPLDFTKYLKTSLH |
| Protein accession: | NP_071896 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Shipping condition: | Dry Ice |