Cart 2 Product Products 368,04 € (empty)
No products
To be determined Shipping
368,04 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 2 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 368,04 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 368,04 €
Data sheet of SEMA4G polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about SEMA4G polyclonal antibody (A01)
| Reference: | H00057715-A01 |
| Product name: | SEMA4G polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant SEMA4G. |
| Gene id: | 57715 |
| Gene name: | SEMA4G |
| Gene alias: | FLJ20590|KIAA1619|MGC102867 |
| Gene description: | sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4G |
| Genbank accession: | NM_017893 |
| Immunogen: | SEMA4G (NP_060363, 24 a.a. ~ 115 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | RRPSRELDATPRMTIPYEELSGTRHFKGQAQNYSTLLLEEASARLLVGARGALFSLSANDIGDGAHKEIHWEASPEMQSKCHQKGKNNQTEC |
| Protein accession: | NP_060363 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Shipping condition: | Dry Ice |