Cart 59 Product Products 21 111,80 € (empty)
No products
To be determined Shipping
21 111,80 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 59 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 21 111,80 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 21 111,80 €
Data sheet of ALPK3 monoclonal antibody (M01), clone 4G4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Monoclonal |
| Host species | Mouse |
| Applications | IHC-P,IF,ELISA,WB-Re |
More info about ALPK3 monoclonal antibody (M01), clone 4G4
| Reference: | H00057538-M01 |
| Product name: | ALPK3 monoclonal antibody (M01), clone 4G4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ALPK3. |
| Clone: | 4G4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 57538 |
| Gene name: | ALPK3 |
| Gene alias: | FLJ12881|FLJ21176|KIAA1330|MAK|MIDORI |
| Gene description: | alpha-kinase 3 |
| Genbank accession: | NM_020778 |
| Immunogen: | ALPK3 (NP_065829, 1811 a.a. ~ 1906 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SSHQCNAYCELLGLTPLKGPEAAHPQAKAKGSKSPSAGRKGSQLSPQPQKKGLPSPQGTRKSAPSSKATPQASEPVTTQLLGQPPTQEEGSKAQGM |
| Protein accession: | NP_065829 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Shipping condition: | Dry Ice |