No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Clonality | Monoclonal |
Host species | Mouse |
Applications | IHC-P,IF,ELISA,WB-Re |
Reference: | H00057538-M01 |
Product name: | ALPK3 monoclonal antibody (M01), clone 4G4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ALPK3. |
Clone: | 4G4 |
Isotype: | IgG1 Kappa |
Gene id: | 57538 |
Gene name: | ALPK3 |
Gene alias: | FLJ12881|FLJ21176|KIAA1330|MAK|MIDORI |
Gene description: | alpha-kinase 3 |
Genbank accession: | NM_020778 |
Immunogen: | ALPK3 (NP_065829, 1811 a.a. ~ 1906 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SSHQCNAYCELLGLTPLKGPEAAHPQAKAKGSKSPSAGRKGSQLSPQPQKKGLPSPQGTRKSAPSSKATPQASEPVTTQLLGQPPTQEEGSKAQGM |
Protein accession: | NP_065829 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Shipping condition: | Dry Ice |