No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Clonality | Monoclonal |
Host species | Mouse |
Applications | IF,ELISA,WB-Re |
Reference: | H00056946-M01 |
Product name: | C11orf30 monoclonal antibody (M01), clone 5D1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant C11orf30. |
Clone: | 5D1 |
Isotype: | IgG3 Kappa |
Gene id: | 56946 |
Gene name: | C11orf30 |
Gene alias: | EMSY|FLJ90741|GL002 |
Gene description: | chromosome 11 open reading frame 30 |
Genbank accession: | NM_020193 |
Immunogen: | C11orf30 (NP_064578, 1081 a.a. ~ 1178 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PASSEKQTASQVEQPIITQGSSVTKITFEGRQPPTVTKITGGSSVPKLTSPVTSISPIQASEKTAVSDILKMSLMEAQIDTNVEHMIVDPPKKALATS |
Protein accession: | NP_064578 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Shipping condition: | Dry Ice |