Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TRPV5 monoclonal antibody (M06), clone 6D6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Monoclonal |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about TRPV5 monoclonal antibody (M06), clone 6D6
| Reference: | H00056302-M06 |
| Product name: | TRPV5 monoclonal antibody (M06), clone 6D6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TRPV5. |
| Clone: | 6D6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 56302 |
| Gene name: | TRPV5 |
| Gene alias: | CAT2|ECAC1|OTRPC3 |
| Gene description: | transient receptor potential cation channel, subfamily V, member 5 |
| Genbank accession: | NM_019841 |
| Immunogen: | TRPV5 (NP_062815, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MGGFLPKAEGPGSQLQKLLPSFLVREQDWDQHLDKLHMLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGALGETALHIAALYDNLEAALVLME |
| Protein accession: | NP_062815 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Shipping condition: | Dry Ice |