Cart 11 Product Products 4 231,84 € (empty)
No products
To be determined Shipping
4 231,84 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 11 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 4 231,84 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 4 231,84 €
Data sheet of ODAM monoclonal antibody (M02), clone 2F8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Monoclonal |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about ODAM monoclonal antibody (M02), clone 2F8
| Reference: | H00054959-M02 |
| Product name: | ODAM monoclonal antibody (M02), clone 2F8 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant ODAM. |
| Clone: | 2F8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 54959 |
| Gene name: | ODAM |
| Gene alias: | APIN|FLJ20513 |
| Gene description: | odontogenic, ameloblast asssociated |
| Genbank accession: | BC017796.1 |
| Immunogen: | ODAM (AAH17796.1, 1 a.a. ~ 153 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MPYVFSFKMPQEQGQMFQYYPVYMVLPWEQPQQTVPRSPQQTRQQQYEEQIPFYAQFGYIPQLAEPAISGGQQQLAFDPQLGTAPEIAVMSTGEEIPYLQKEAINFRHDSAGVFMPSTSPKPSTTNVFTSAVDQTITPELPEEKDKTDSLREP |
| Protein accession: | AAH17796.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Shipping condition: | Dry Ice |