Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of POLR3K monoclonal antibody (M01), clone 3F5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Monoclonal |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about POLR3K monoclonal antibody (M01), clone 3F5
| Reference: | H00051728-M01 |
| Product name: | POLR3K monoclonal antibody (M01), clone 3F5 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant POLR3K. |
| Clone: | 3F5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 51728 |
| Gene name: | POLR3K |
| Gene alias: | C11|C11-RNP3|My010|RPC10|RPC11|hRPC11 |
| Gene description: | polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa |
| Genbank accession: | BC011932 |
| Immunogen: | POLR3K (AAH11932, 1 a.a. ~ 108 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD |
| Protein accession: | AAH11932 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Shipping condition: | Dry Ice |