Cart 47 Product Products 17 649,40 € (empty)
No products
To be determined Shipping
17 649,40 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 47 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 17 649,40 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 17 649,40 €
Data sheet of ACSL5 monoclonal antibody (M01), clone 5H8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Monoclonal |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
More info about ACSL5 monoclonal antibody (M01), clone 5H8
| Reference: | H00051703-M01 |
| Product name: | ACSL5 monoclonal antibody (M01), clone 5H8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ACSL5. |
| Clone: | 5H8 |
| Isotype: | IgG1 Kappa |
| Gene id: | 51703 |
| Gene name: | ACSL5 |
| Gene alias: | ACS2|ACS5|FACL5 |
| Gene description: | acyl-CoA synthetase long-chain family member 5 |
| Genbank accession: | NM_016234 |
| Immunogen: | ACSL5 (NP_057318, 91 a.a. ~ 186 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PQPVLPLLDLNNQSVGIEGGARKGVSQKNNDLTSCCFSDAKTMYEVFQRGLAVSDNGPCLGYRKPNQPYRWLSYKQVSDRAEYLGSCLLHKGYKSS |
| Protein accession: | NP_057318 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Shipping condition: | Dry Ice |