| Reference: | H00051619-Q01 |
| Product name: | UBE2D4 (Human) Recombinant Protein (Q01) |
| Product description: | Human UBE2D4 partial ORF ( NP_057067, 1 a.a. - 94 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 51619 |
| Gene name: | UBE2D4 |
| Gene alias: | HBUCE1 |
| Gene description: | ubiquitin-conjugating enzyme E2D 4 (putative) |
| Genbank accession: | NM_015983 |
| Immunogen sequence/protein sequence: | MALKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWS |
| Protein accession: | NP_057067 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Shipping condition: | Dry Ice |