Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GLRX5 monoclonal antibody (M04), clone 4G8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Monoclonal |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about GLRX5 monoclonal antibody (M04), clone 4G8
| Reference: | H00051218-M04 |
| Product name: | GLRX5 monoclonal antibody (M04), clone 4G8 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant GLRX5. |
| Clone: | 4G8 |
| Isotype: | IgG2b Kappa |
| Gene id: | 51218 |
| Gene name: | GLRX5 |
| Gene alias: | C14orf87|FLB4739|GRX5|MGC14129|PR01238|PRO1238 |
| Gene description: | glutaredoxin 5 |
| Genbank accession: | NM_016417.2 |
| Immunogen: | GLRX5 (NP_057501.2, 1 a.a. ~ 157 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSGSLGRAAAALLRWGRGAGGGGLWGPGVRAAGSGAGGGGSAEQLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLVEELKKLGIHSALLDEKKDQDSK |
| Protein accession: | NP_057501.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Shipping condition: | Dry Ice |