Cart 79 Product Products 28 610,25 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Phospho-FG...259,07 € -
1 x IL-4I1...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x TPX2...259,07 € -
-
-
-
-
1 x LAT...259,07 € -
-
-
-
-
-
-
1 x HSF-27...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
28 610,25 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 79 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 28 610,25 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 28 610,25 €
Data sheet of PLA2G3 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about PLA2G3 polyclonal antibody (A01)
| Reference: | H00050487-A01 |
| Product name: | PLA2G3 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant PLA2G3. |
| Gene id: | 50487 |
| Gene name: | PLA2G3 |
| Gene alias: | GIII-SPLA2|SPLA2III |
| Gene description: | phospholipase A2, group III |
| Genbank accession: | NM_015715 |
| Immunogen: | PLA2G3 (NP_056530, 21 a.a. ~ 130 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | SPALRWYRTSCHLTKAVPGNPLGYLSFLAKDAQGLALIHARWDAHRRLQACSWEDEPELTAAYGALCAHETAWGSFIHTPGPELQRALATLQSQWEACRALEESPAGARK |
| Protein accession: | NP_056530 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Shipping condition: | Dry Ice |