| Reference: | H00029930-A01 |
| Product name: | PCDHB1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant PCDHB1. |
| Gene id: | 29930 |
| Gene name: | PCDHB1 |
| Gene alias: | MGC138301|MGC138303|PCDH-BETA1 |
| Gene description: | protocadherin beta 1 |
| Genbank accession: | NM_013340 |
| Immunogen: | PCDHB1 (NP_037472, 241 a.a. ~ 340 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | QFSRLVYRAQVSENSPNGSLVATVTAVDLDEGTNKAITYSLAQNPEAILKTFQIDPQNGEVRLRGPLDFEAIETYDIDIQATDGGGLSAHSKVLVEVVDV |
| Protein accession: | NP_037472 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Shipping condition: | Dry Ice |