Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of DHDH polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about DHDH polyclonal antibody (A01)
| Reference: | H00027294-A01 |
| Product name: | DHDH polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant DHDH. |
| Gene id: | 27294 |
| Gene name: | DHDH |
| Gene alias: | HUM2DD |
| Gene description: | dihydrodiol dehydrogenase (dimeric) |
| Genbank accession: | NM_014475 |
| Immunogen: | DHDH (NP_055290, 235 a.a. ~ 334 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | SNTASVSGTKGMAQLLNPCWCPTELVVKGEHKEFPLPPVPKDCNFDNGAGMSYEAKHVWECLRKGMKESPVIPLSESELLADILEEVRKAIGVTFPQDKR |
| Protein accession: | NP_055290 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Shipping condition: | Dry Ice |